PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 357aa    MW: 40517.6 Da    PI: 6.7138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27247.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.12.8e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l d++ ++G gtW+t +++ g++R++k+c++rw +yl
       KHN27247.1 14 KGPWTPEEDEKLMDYISKHGRGTWRTLPKHAGLNRCGKSCRLRWENYL 61
                     79********************************************97 PP

2Myb_DNA-binding569e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE++l+++++   G++ W++Ia +++ gRt++++k++w++ 
       KHN27247.1  67 RGKFTEEEEQLIINLHSVIGNK-WAKIATHLP-GRTDNEIKNYWNTN 111
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.436961IPR017930Myb domain
SuperFamilySSF466895.24E-3211108IPR009057Homeodomain-like
SMARTSM007173.7E-151363IPR001005SANT/Myb domain
PfamPF002491.1E-171461IPR001005SANT/Myb domain
CDDcd001671.47E-111661No hitNo description
PROSITE profilePS5129428.03862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2665116IPR009057Homeodomain-like
SMARTSM007174.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667112IPR001005SANT/Myb domain
CDDcd001671.96E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRPPCCNES GVKKGPWTPE EDEKLMDYIS KHGRGTWRTL PKHAGLNRCG KSCRLRWENY  60
LRPDIKRGKF TEEEEQLIIN LHSVIGNKWA KIATHLPGRT DNEIKNYWNT NLRKKLLQMG  120
IDPETHKPRT DFNHLLNLSQ LLGLSNLGTS TSPWTNPLGL QADVTQIAKL QLLQNMLQLF  180
NGTSLVNIGN PYLLGNQILN PLDTFLNGTN ILPDKDSILR GLEYANPVGN NSGLFLSQTY  240
SDSSVFKSRT EKENETNQEF LGYNQSISTF PENQAENLLP ALVASGPRSS TFNQMDFNYN  300
AARMSTQSPS TTFEAWEKFL IDDDESSGSY WKEILEYVLF STDLPCSYCY VHMHASR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352680.0AC235268.1 Glycine max strain Williams 82 clone GM_WBb0044I02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548667.20.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0B2R6330.0A0A0B2R633_GLYSO; Transcription factor MYB39
STRINGGLYMA16G13440.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.11e-83myb domain protein 107
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]